GCM2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2084116
Artikelname: GCM2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2084116
Hersteller Artikelnummer: orb2084116
Alternativnummer: BYT-ORB2084116-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human GCM2
Konjugation: Biotin
Alternative Synonym: FIH2, GCMB, HRPT4, hGCMb
GCM2 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 57kDa
NCBI: 004743
UniProt: O75603
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: HSGYPVTNFWRLDGNAIFFQAKGVHDHPRPESKSETEARRSAIKRQMASF