GCM2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2084116
Article Name: GCM2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2084116
Supplier Catalog Number: orb2084116
Alternative Catalog Number: BYT-ORB2084116-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human GCM2
Conjugation: Biotin
Alternative Names: FIH2, GCMB, HRPT4, hGCMb
GCM2 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 57kDa
NCBI: 004743
UniProt: O75603
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: HSGYPVTNFWRLDGNAIFFQAKGVHDHPRPESKSETEARRSAIKRQMASF