MATK Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2084245
Artikelname: MATK Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2084245
Hersteller Artikelnummer: orb2084245
Alternativnummer: BYT-ORB2084245-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human MATK
Konjugation: Biotin
Alternative Synonym: CHK, CTK, HYL, Lsk, HYLTK, HHYLTK
MATK Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 55kDa
NCBI: 647612
UniProt: P42679
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: SSCWEAEPARRPPFRKLAEKLARELRSAGAPASVSGQDADGSTSPRSQEP