MATK Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2084245
Article Name: MATK Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2084245
Supplier Catalog Number: orb2084245
Alternative Catalog Number: BYT-ORB2084245-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human MATK
Conjugation: Biotin
Alternative Names: CHK, CTK, HYL, Lsk, HYLTK, HHYLTK
MATK Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 55kDa
NCBI: 647612
UniProt: P42679
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: SSCWEAEPARRPPFRKLAEKLARELRSAGAPASVSGQDADGSTSPRSQEP