SP100 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2084260
Artikelname: SP100 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2084260
Hersteller Artikelnummer: orb2084260
Alternativnummer: BYT-ORB2084260-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human SP100
Konjugation: Biotin
Alternative Synonym: lysp100b
SP100 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 96kDa
NCBI: 003104
UniProt: P23497
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: IIVISSEDSEGSTDVDEPLEVFISAPRSEPVINNDNPLESNDEKEGQEAT