SP100 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2084260
Article Name: SP100 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2084260
Supplier Catalog Number: orb2084260
Alternative Catalog Number: BYT-ORB2084260-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human SP100
Conjugation: Biotin
Alternative Names: lysp100b
SP100 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 96kDa
NCBI: 003104
UniProt: P23497
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: IIVISSEDSEGSTDVDEPLEVFISAPRSEPVINNDNPLESNDEKEGQEAT