HOXA9 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2084278
Artikelname: HOXA9 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2084278
Hersteller Artikelnummer: orb2084278
Alternativnummer: BYT-ORB2084278-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human HOXA9
Konjugation: Biotin
Alternative Synonym: HOX1, ABD-B, HOX1G, HOX1.7
HOXA9 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 29kDa
NCBI: 689952
UniProt: P31269
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: LSLTDYACGSPPVDREKQPSEGAFSENNAENESGGDKPPIDPNNPAANWL