HOXA9 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Catalog Number:
BYT-ORB2084278
| Article Name: |
HOXA9 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Biozol Catalog Number: |
BYT-ORB2084278 |
| Supplier Catalog Number: |
orb2084278 |
| Alternative Catalog Number: |
BYT-ORB2084278-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human HOXA9 |
| Conjugation: |
Biotin |
| Alternative Names: |
HOX1, ABD-B, HOX1G, HOX1.7 |
| HOXA9 Rabbit Polyclonal Antibody (Biotin) |
| Clonality: |
Polyclonal |
| Molecular Weight: |
29kDa |
| NCBI: |
689952 |
| UniProt: |
P31269 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: LSLTDYACGSPPVDREKQPSEGAFSENNAENESGGDKPPIDPNNPAANWL |
