GSS Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2084308
Artikelname: GSS Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2084308
Hersteller Artikelnummer: orb2084308
Alternativnummer: BYT-ORB2084308-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human GSS
Konjugation: Biotin
Alternative Synonym: GSHS, HEL-S-64p, HEL-S-88n
GSS Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 52kDa
NCBI: 005260463
UniProt: P48637
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: EEGDQAIAEALAAPSRFVLKPQREGGGNNLYGEEMVQALKQLKDSEERAS