GSS Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2084308
Article Name: GSS Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2084308
Supplier Catalog Number: orb2084308
Alternative Catalog Number: BYT-ORB2084308-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human GSS
Conjugation: Biotin
Alternative Names: GSHS, HEL-S-64p, HEL-S-88n
GSS Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 52kDa
NCBI: 005260463
UniProt: P48637
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: EEGDQAIAEALAAPSRFVLKPQREGGGNNLYGEEMVQALKQLKDSEERAS