OGT Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2084344
Artikelname: OGT Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2084344
Hersteller Artikelnummer: orb2084344
Alternativnummer: BYT-ORB2084344-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human OGT
Konjugation: Biotin
Alternative Synonym: OGT1, HRNT1, MRX106, HINCUT-1, O-GLCNAC
OGT Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 101kDa
UniProt: O15294
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: LAIDTYRRAIELQPHFPDAYCNLANALKEKGSVAEAEDCYNTALRLCPTH