OGT Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2084344
Article Name: OGT Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2084344
Supplier Catalog Number: orb2084344
Alternative Catalog Number: BYT-ORB2084344-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human OGT
Conjugation: Biotin
Alternative Names: OGT1, HRNT1, MRX106, HINCUT-1, O-GLCNAC
OGT Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 101kDa
UniProt: O15294
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: LAIDTYRRAIELQPHFPDAYCNLANALKEKGSVAEAEDCYNTALRLCPTH