Rab11b Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer:
BYT-ORB2084389
| Artikelname: |
Rab11b Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Artikelnummer: |
BYT-ORB2084389 |
| Hersteller Artikelnummer: |
orb2084389 |
| Alternativnummer: |
BYT-ORB2084389-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Immunogen: |
The immunogen for Anti-Rab11b antibody is: synthetic peptide directed towards the C-terminal of Rat RB11B |
| Konjugation: |
Biotin |
| Rab11b Rabbit Polyclonal Antibody (Biotin) |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
23 kDa |
| NCBI: |
116006 |
| UniProt: |
O35509 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: KNILTEIYRIVSQKQIADRAAHDESPGNNVVDISVPPTTDGQKPNKLQCC |
