Rab11b Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Catalog Number:
BYT-ORB2084389
| Article Name: |
Rab11b Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Biozol Catalog Number: |
BYT-ORB2084389 |
| Supplier Catalog Number: |
orb2084389 |
| Alternative Catalog Number: |
BYT-ORB2084389-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Immunogen: |
The immunogen for Anti-Rab11b antibody is: synthetic peptide directed towards the C-terminal of Rat RB11B |
| Conjugation: |
Biotin |
| Rab11b Rabbit Polyclonal Antibody (Biotin) |
| Clonality: |
Polyclonal |
| Molecular Weight: |
23 kDa |
| NCBI: |
116006 |
| UniProt: |
O35509 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: KNILTEIYRIVSQKQIADRAAHDESPGNNVVDISVPPTTDGQKPNKLQCC |
