OR4F3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2084494
Artikelname: OR4F3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2084494
Hersteller Artikelnummer: orb2084494
Alternativnummer: BYT-ORB2084494-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR4F3
Konjugation: Biotin
Alternative Synonym: OR4F29,
OR4F3 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 34kDa
NCBI: 001005224
UniProt: Q6IEY1
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: VTVNSGFICVGTFFILLISYVFILFTVWKHSSGGSSKALSTLSAHSTVVL