OR4F3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2084494
Article Name: OR4F3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2084494
Supplier Catalog Number: orb2084494
Alternative Catalog Number: BYT-ORB2084494-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR4F3
Conjugation: Biotin
Alternative Names: OR4F29,
OR4F3 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 34kDa
NCBI: 001005224
UniProt: Q6IEY1
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: VTVNSGFICVGTFFILLISYVFILFTVWKHSSGGSSKALSTLSAHSTVVL