ZDHHC20 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2084680
Artikelname: ZDHHC20 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2084680
Hersteller Artikelnummer: orb2084680
Alternativnummer: BYT-ORB2084680-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of human ZDHHC20
Konjugation: Biotin
Alternative Synonym: DHHC20, DHHC-20, 4933421L13Rik
ZDHHC20 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 32kDa
NCBI: 001273567
UniProt: B4DRN8
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: IFTSPASPSKEFYLSNSEKERYEKEFSQERQQEILRRAARALPIYTTSAS