ZDHHC20 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Catalog Number:
BYT-ORB2084680
| Article Name: |
ZDHHC20 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Biozol Catalog Number: |
BYT-ORB2084680 |
| Supplier Catalog Number: |
orb2084680 |
| Alternative Catalog Number: |
BYT-ORB2084680-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N-terminal region of human ZDHHC20 |
| Conjugation: |
Biotin |
| Alternative Names: |
DHHC20, DHHC-20, 4933421L13Rik |
| ZDHHC20 Rabbit Polyclonal Antibody (Biotin) |
| Clonality: |
Polyclonal |
| Molecular Weight: |
32kDa |
| NCBI: |
001273567 |
| UniProt: |
B4DRN8 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: IFTSPASPSKEFYLSNSEKERYEKEFSQERQQEILRRAARALPIYTTSAS |
