ROGDI Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2085040
Artikelname: ROGDI Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2085040
Hersteller Artikelnummer: orb2085040
Alternativnummer: BYT-ORB2085040-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human ROGDI
Konjugation: Biotin
Alternative Synonym: KTZS
ROGDI Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 31kDa
NCBI: 078865
UniProt: Q9GZN7
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: VHAVLKQLQDILKEASLRFTLPGSGTEGPAKQENFILGSCGTDQVKGVLT