ROGDI Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2085040
Article Name: ROGDI Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2085040
Supplier Catalog Number: orb2085040
Alternative Catalog Number: BYT-ORB2085040-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human ROGDI
Conjugation: Biotin
Alternative Names: KTZS
ROGDI Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 31kDa
NCBI: 078865
UniProt: Q9GZN7
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: VHAVLKQLQDILKEASLRFTLPGSGTEGPAKQENFILGSCGTDQVKGVLT