RMND5A Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2085055
Artikelname: RMND5A Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2085055
Hersteller Artikelnummer: orb2085055
Alternativnummer: BYT-ORB2085055-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human RMND5A
Konjugation: Biotin
Alternative Synonym: CTLH, GID2, RMD5, GID2A, p44CTLH
RMND5A Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 43kDa
NCBI: 073617
UniProt: Q9H871
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: LDVAEELCQESGLSVDPSQKEPFVELNRILEALKVRVLRPALEWAVSNRE