RMND5A Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2085055
Article Name: RMND5A Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2085055
Supplier Catalog Number: orb2085055
Alternative Catalog Number: BYT-ORB2085055-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human RMND5A
Conjugation: Biotin
Alternative Names: CTLH, GID2, RMD5, GID2A, p44CTLH
RMND5A Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 43kDa
NCBI: 073617
UniProt: Q9H871
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: LDVAEELCQESGLSVDPSQKEPFVELNRILEALKVRVLRPALEWAVSNRE