OR10H4 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2085352
Artikelname: OR10H4 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2085352
Hersteller Artikelnummer: orb2085352
Alternativnummer: BYT-ORB2085352-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human OR10H4
Konjugation: Biotin
Alternative Synonym: OR19-28
OR10H4 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 34kDa
NCBI: 001004465
UniProt: Q8NGA5
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: HVLSLLKLACENKTSSVIMGVMLVCVTALIGCLFLIILSYVFIVAAILRI