OR10H4 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2085352
Article Name: OR10H4 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2085352
Supplier Catalog Number: orb2085352
Alternative Catalog Number: BYT-ORB2085352-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human OR10H4
Conjugation: Biotin
Alternative Names: OR19-28
OR10H4 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 34kDa
NCBI: 001004465
UniProt: Q8NGA5
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: HVLSLLKLACENKTSSVIMGVMLVCVTALIGCLFLIILSYVFIVAAILRI