OR2M2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2085673
Artikelname: OR2M2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2085673
Hersteller Artikelnummer: orb2085673
Alternativnummer: BYT-ORB2085673-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR2M2
Konjugation: Biotin
Alternative Synonym: OR2M2Q, OST423
OR2M2 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 38kDa
NCBI: 001004688
UniProt: Q96R28
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: DKMVSVFYTILTPMLNPLIYSLRNKEVTRAFMKILGKGKSESELPHKLYV