OR2M2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2085673
Article Name: OR2M2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2085673
Supplier Catalog Number: orb2085673
Alternative Catalog Number: BYT-ORB2085673-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR2M2
Conjugation: Biotin
Alternative Names: OR2M2Q, OST423
OR2M2 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 38kDa
NCBI: 001004688
UniProt: Q96R28
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: DKMVSVFYTILTPMLNPLIYSLRNKEVTRAFMKILGKGKSESELPHKLYV