OR1F1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer:
BYT-ORB2085721
| Artikelname: |
OR1F1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Artikelnummer: |
BYT-ORB2085721 |
| Hersteller Artikelnummer: |
orb2085721 |
| Alternativnummer: |
BYT-ORB2085721-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR1F1 |
| Konjugation: |
Biotin |
| Alternative Synonym: |
OLFMF, OR1F4, OR1F5, OR1F6, OR1F7, OR1F8, OR1F9, OR1F10, OR16-36, OR16-37, OR16-88, OR16-89, OR16-90, OR1F13P, OR3-145, ORL1023 |
| OR1F1 Rabbit Polyclonal Antibody (Biotin) |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
34 kDa |
| NCBI: |
036492 |
| UniProt: |
O43749 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: FNPLSSHSAEKDTMATVLYTVVTPMLNPFIYSLRNRYLKGALKKVVGRVV |
