OR1F1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Catalog Number:
BYT-ORB2085721
| Article Name: |
OR1F1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Biozol Catalog Number: |
BYT-ORB2085721 |
| Supplier Catalog Number: |
orb2085721 |
| Alternative Catalog Number: |
BYT-ORB2085721-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR1F1 |
| Conjugation: |
Biotin |
| Alternative Names: |
OLFMF, OR1F4, OR1F5, OR1F6, OR1F7, OR1F8, OR1F9, OR1F10, OR16-36, OR16-37, OR16-88, OR16-89, OR16-90, OR1F13P, OR3-145, ORL1023 |
| OR1F1 Rabbit Polyclonal Antibody (Biotin) |
| Clonality: |
Polyclonal |
| Molecular Weight: |
34 kDa |
| NCBI: |
036492 |
| UniProt: |
O43749 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: FNPLSSHSAEKDTMATVLYTVVTPMLNPFIYSLRNRYLKGALKKVVGRVV |
