OBP2A Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2085733
Artikelname: OBP2A Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2085733
Hersteller Artikelnummer: orb2085733
Alternativnummer: BYT-ORB2085733-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human OBP2A
Konjugation: Biotin
Alternative Synonym: OBP, LCN13, OBP2C, OBPIIa, hOBPIIa
OBP2A Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 25kDa
UniProt: Q9NY56
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: PVKVTALGGGNLEATFTFMREDRCIQKKILMRKTEEPGKFSAYGGRKLIY