OBP2A Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2085733
Article Name: OBP2A Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2085733
Supplier Catalog Number: orb2085733
Alternative Catalog Number: BYT-ORB2085733-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human OBP2A
Conjugation: Biotin
Alternative Names: OBP, LCN13, OBP2C, OBPIIa, hOBPIIa
OBP2A Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 25kDa
UniProt: Q9NY56
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: PVKVTALGGGNLEATFTFMREDRCIQKKILMRKTEEPGKFSAYGGRKLIY