HEATR3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2086240
Artikelname: HEATR3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2086240
Hersteller Artikelnummer: orb2086240
Alternativnummer: BYT-ORB2086240-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human HEATR3
Konjugation: Biotin
Alternative Synonym: SYO1
HEATR3 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 35kDa
NCBI: 891552
UniProt: Q7Z4Q2
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: KECSAGLDSNEMSLQEKKDQNRNSIENIANETVNVLWNICECSSRAVSIF