HEATR3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2086240
Article Name: HEATR3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2086240
Supplier Catalog Number: orb2086240
Alternative Catalog Number: BYT-ORB2086240-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human HEATR3
Conjugation: Biotin
Alternative Names: SYO1
HEATR3 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 35kDa
NCBI: 891552
UniProt: Q7Z4Q2
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: KECSAGLDSNEMSLQEKKDQNRNSIENIANETVNVLWNICECSSRAVSIF