HAUS2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2086249
Artikelname: HAUS2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2086249
Hersteller Artikelnummer: orb2086249
Alternativnummer: BYT-ORB2086249-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human HAUS2
Konjugation: Biotin
Alternative Synonym: CEP27, C15orf25, HsT17025
HAUS2 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 25kDa
NCBI: 060567
UniProt: Q9NVX0
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: LAENILKWRKQQNEVSSCIPKILAEESYLYKHDIIMPPLPFTSKVHVQTI