HAUS2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2086249
Article Name: HAUS2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2086249
Supplier Catalog Number: orb2086249
Alternative Catalog Number: BYT-ORB2086249-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human HAUS2
Conjugation: Biotin
Alternative Names: CEP27, C15orf25, HsT17025
HAUS2 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 25kDa
NCBI: 060567
UniProt: Q9NVX0
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: LAENILKWRKQQNEVSSCIPKILAEESYLYKHDIIMPPLPFTSKVHVQTI