FAM111B Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2086453
Artikelname: FAM111B Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2086453
Hersteller Artikelnummer: orb2086453
Alternativnummer: BYT-ORB2086453-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human FAM111B
Konjugation: Biotin
Alternative Synonym: CANP, POIKTMP
FAM111B Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 81kDa
NCBI: 001136175
UniProt: Q6SJ93
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: GFNVHALIEFGYSMDSILCDIKKTNESLYKSLNDEKLETYDEEKGKQESS