FAM111B Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2086453
Article Name: FAM111B Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2086453
Supplier Catalog Number: orb2086453
Alternative Catalog Number: BYT-ORB2086453-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human FAM111B
Conjugation: Biotin
Alternative Names: CANP, POIKTMP
FAM111B Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 81kDa
NCBI: 001136175
UniProt: Q6SJ93
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: GFNVHALIEFGYSMDSILCDIKKTNESLYKSLNDEKLETYDEEKGKQESS