CCDC107 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2087203
Artikelname: CCDC107 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2087203
Hersteller Artikelnummer: orb2087203
Alternativnummer: BYT-ORB2087203-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human CCDC107
Konjugation: Biotin
Alternative Synonym: PSEC0222
CCDC107 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 31kDa
NCBI: 777583
UniProt: Q8WV48
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: NMKLWTIHELLQDSKPDKDMEASEPGEGSGGESAGGGDKVSETGTFLISP