CCDC107 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2087203
Article Name: CCDC107 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2087203
Supplier Catalog Number: orb2087203
Alternative Catalog Number: BYT-ORB2087203-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human CCDC107
Conjugation: Biotin
Alternative Names: PSEC0222
CCDC107 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 31kDa
NCBI: 777583
UniProt: Q8WV48
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: NMKLWTIHELLQDSKPDKDMEASEPGEGSGGESAGGGDKVSETGTFLISP