GCSAML Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2087269
Artikelname: GCSAML Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2087269
Hersteller Artikelnummer: orb2087269
Alternativnummer: BYT-ORB2087269-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human GCSAML
Konjugation: Biotin
Alternative Synonym: C1orf150
GCSAML Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 14kDa
NCBI: 660321
UniProt: Q5JQS6
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: ENQKKPKKGNPDEERKRQEMTTFERKLQDQDKKSQEVSSTSNQENENGSG