GCSAML Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2087269
Article Name: GCSAML Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2087269
Supplier Catalog Number: orb2087269
Alternative Catalog Number: BYT-ORB2087269-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human GCSAML
Conjugation: Biotin
Alternative Names: C1orf150
GCSAML Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 14kDa
NCBI: 660321
UniProt: Q5JQS6
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: ENQKKPKKGNPDEERKRQEMTTFERKLQDQDKKSQEVSSTSNQENENGSG