C11orf40 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2087311
Artikelname: C11orf40 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2087311
Hersteller Artikelnummer: orb2087311
Alternativnummer: BYT-ORB2087311-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human C11orf40
Konjugation: Biotin
Alternative Synonym: 45231
C11orf40 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 24kDa
NCBI: 653264
UniProt: Q8WZ69
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: VPREREPKLSILQMDRGDPQHSSHWCPEREKVKLLTLKPRETSKNILINF