C11orf40 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2087311
Article Name: C11orf40 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2087311
Supplier Catalog Number: orb2087311
Alternative Catalog Number: BYT-ORB2087311-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human C11orf40
Conjugation: Biotin
Alternative Names: 45231
C11orf40 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 24kDa
NCBI: 653264
UniProt: Q8WZ69
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: VPREREPKLSILQMDRGDPQHSSHWCPEREKVKLLTLKPRETSKNILINF