AGAP4 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2087404
Artikelname: AGAP4 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2087404
Hersteller Artikelnummer: orb2087404
Alternativnummer: BYT-ORB2087404-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human AGAP4
Konjugation: Biotin
Alternative Synonym: AGAP8, MRIP2, AGAP-4, AGAP-8, CTGLF1, CTGLF5
AGAP4 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 73kDa
NCBI: 597703
UniProt: Q96P64
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: WPVELRKVMSSIGNDLANSIWEGSSQGQTKPSEKSTREEKERWIRSKYEE