AGAP4 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2087404
Article Name: AGAP4 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2087404
Supplier Catalog Number: orb2087404
Alternative Catalog Number: BYT-ORB2087404-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human AGAP4
Conjugation: Biotin
Alternative Names: AGAP8, MRIP2, AGAP-4, AGAP-8, CTGLF1, CTGLF5
AGAP4 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 73kDa
NCBI: 597703
UniProt: Q96P64
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: WPVELRKVMSSIGNDLANSIWEGSSQGQTKPSEKSTREEKERWIRSKYEE