Ccdc47 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer:
BYT-ORB2087920
| Artikelname: |
Ccdc47 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Artikelnummer: |
BYT-ORB2087920 |
| Hersteller Artikelnummer: |
orb2087920 |
| Alternativnummer: |
BYT-ORB2087920-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Ccdc47 |
| Konjugation: |
Biotin |
| Alternative Synonym: |
a, cal, asp4, C88307, calumin, 2610204L23Rik |
| Ccdc47 Rabbit Polyclonal Antibody (Biotin) |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
53kDa |
| NCBI: |
080285 |
| UniProt: |
Q9D024 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: ADKNRARVEENFLKLTHVQRQEAAQSRREEKKRAEKERIMNEEDPEKQRR |
