Ccdc47 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Catalog Number:
BYT-ORB2087920
| Article Name: |
Ccdc47 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Biozol Catalog Number: |
BYT-ORB2087920 |
| Supplier Catalog Number: |
orb2087920 |
| Alternative Catalog Number: |
BYT-ORB2087920-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Ccdc47 |
| Conjugation: |
Biotin |
| Alternative Names: |
a, cal, asp4, C88307, calumin, 2610204L23Rik |
| Ccdc47 Rabbit Polyclonal Antibody (Biotin) |
| Clonality: |
Polyclonal |
| Molecular Weight: |
53kDa |
| NCBI: |
080285 |
| UniProt: |
Q9D024 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: ADKNRARVEENFLKLTHVQRQEAAQSRREEKKRAEKERIMNEEDPEKQRR |
