GPATCH2L Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2087968
Artikelname: GPATCH2L Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2087968
Hersteller Artikelnummer: orb2087968
Alternativnummer: BYT-ORB2087968-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human GPATCH2L
Konjugation: Biotin
Alternative Synonym: C14orf118
GPATCH2L Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 54kDa
NCBI: 060396
UniProt: Q9NWQ4
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: SRWKENTPWTSSGHGLCESAENRTFLSKTGRKERMECETDEQKQGSDENM