GPATCH2L Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2087968
Article Name: GPATCH2L Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2087968
Supplier Catalog Number: orb2087968
Alternative Catalog Number: BYT-ORB2087968-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human GPATCH2L
Conjugation: Biotin
Alternative Names: C14orf118
GPATCH2L Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 54kDa
NCBI: 060396
UniProt: Q9NWQ4
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: SRWKENTPWTSSGHGLCESAENRTFLSKTGRKERMECETDEQKQGSDENM