FGFBP3 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Artikelnummer: BYT-ORB2088311
Artikelname: FGFBP3 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Artikelnummer: BYT-ORB2088311
Hersteller Artikelnummer: orb2088311
Alternativnummer: BYT-ORB2088311-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human FGFBP3
Konjugation: HRP
Alternative Synonym: FGF-BP3, C10orf13
FGFBP3 Rabbit Polyclonal Antibody (HRP)
Klonalität: Polyclonal
Molekulargewicht: 28kDa
NCBI: 689642
UniProt: Q8TAT2
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: GTPPPQSAPPKENPSERKTNEGKRKAALVPNEERPMGTGPDPDGLDGNAE