FGFBP3 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2088311
Article Name: FGFBP3 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2088311
Supplier Catalog Number: orb2088311
Alternative Catalog Number: BYT-ORB2088311-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human FGFBP3
Conjugation: HRP
Alternative Names: FGF-BP3, C10orf13
FGFBP3 Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 28kDa
NCBI: 689642
UniProt: Q8TAT2
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: GTPPPQSAPPKENPSERKTNEGKRKAALVPNEERPMGTGPDPDGLDGNAE